ACHTUNG. Das ist ein Archiv des alten forum.ruby-portal.de. Die aktuelle Mailingliste gibt es auf lists.ruby-lang.org/pipermail/ruby-de.

NOTICE. This is a ready-only copy of the old forum.ruby-portal.de. You can find the current mailing list at lists.ruby-lang.org/pipermail/ruby-de.

Die Programmiersprache Ruby

Blog|

Forum|

Wiki  


Alle Zeiten sind UTC + 1 Stunde [ Sommerzeit ]

Ein neues Thema erstellen Auf das Thema antworten  [ 7 Beiträge ] 
Autor Nachricht
 Betreff des Beitrags: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 13 Jun 2016, 15:40 
Offline
Nuby

Registriert: 13 Jun 2016, 15:34
Beiträge: 4
Hallo,
ich wollte ein Beispiel wir hier in dem Link beschrieben ist erzeugen:
http://www.ibm.com/developerworks/library/os-ws-rubyrails/

Leider bekomme ich folgende Fehlermeldung: uninitialized constant ActionWebService
also hier das problem
class HelloMessageApi < ActionWebService::API::Base
api_method :hello_message, :expects => [{:firstname=>:string},
{:lastname=>:string}], :returns => [:string]
end
die gem ActionWebService ist installiert

habt Ihr vielleicht eine Idee?


Nach oben
 Profil  
 
 Betreff des Beitrags: Re: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 13 Jun 2016, 15:45 
Offline
Metaprogrammierer

Registriert: 20 Nov 2011, 21:51
Beiträge: 693
Das von dir verlinkte Beispiel ist fast 8 Jahre alt (November 2008) und verwendet zum starten von WEBrick noch die Variante wie sie mit Rails 2.x zuletzt genutzt wurde.

Es wird dir nur bleiben ein aktuelleres Beispiel zu suchen (empfohlen) oder herauszufinden mit welcher Rails-Version das genau gemacht wurde (inklusive Abhängigkeiten) und dann dahin downzugraden (eher nicht empfohlen).

edit

Gerade noch mal in die Kommentare geguckt. Einer der Kommentare spricht sogar davon, dass die Funktionalität bereits in Rails 2.0 entfernt wurde, daraus ist zu folgern, dass der verlinkte Inhalt sich noch auf Rails 1.x bezieht und damit besser nicht weiter beachtet werden sollte.

_________________
Ubuntu Gnome 14.04 LTS
rvm mit App-spezifischer Ruby-Version (meist 2.2.x) und -Gemset

Github ProfilBitbucket Profil


Nach oben
 Profil  
 
 Betreff des Beitrags: Re: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 13 Jun 2016, 15:56 
Offline
Nuby

Registriert: 13 Jun 2016, 15:34
Beiträge: 4
Hallo
Danke für die Antwort,
dann schau ich mal weiter, leider hab ich noch eine rails 2.1.2 :?
nun ist die Anforderung Daten über einen Webservice (WSDL) zu senden bzw.
zu händeln.
Habt Ihr vielleicht schon Erfahrung damit gemacht?

Grüsse


Nach oben
 Profil  
 
 Betreff des Beitrags: Re: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 13 Jun 2016, 16:22 
Offline
Metaprogrammierer

Registriert: 20 Nov 2011, 21:51
Beiträge: 693
Bei solch einem alten Rails sollte es vielleicht vorrangig sein es halbwegs upzudaten statt noch zu versuchen die leidensverlängernden Maßnahmen einzuleiten.

Sollte es keine Möglichkeit geben auf ein neueres Rails zu gehen, bleibt wohl nur aus der Fülle der Forks von actionwebservice, eben jenen rauszusuchen der mit deiner Rails Version funktioniert:

https://rubygems.org/search?utf8=%E2%9C%93&query=actionwebservice

_________________
Ubuntu Gnome 14.04 LTS
rvm mit App-spezifischer Ruby-Version (meist 2.2.x) und -Gemset

Github ProfilBitbucket Profil


Nach oben
 Profil  
 
 Betreff des Beitrags: Re: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 14 Jun 2016, 08:47 
Offline
Nuby

Registriert: 13 Jun 2016, 15:34
Beiträge: 4
Du hast vollkommen Recht bloss versuch ich das schon seit Jahren meinen Chefs zu erzählen
leider ist da kein Einsehen ich könnte ko...
Danke für den Tipp

Grüsse


Nach oben
 Profil  
 
 Betreff des Beitrags: Re: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 14 Jun 2016, 09:16 
Offline
Interpreter

Registriert: 10 Dez 2007, 17:37
Beiträge: 1906
Erstmal kann ich NobbZ nur zustimmen. Vielleicht überzeugt ja deinen Chef ein Blick auf CVE Database.

Aber egal, ich vermute es fehlt ein




config.gem 'actionwebservice'


oder etwas ähnliches in der environment.rb. Wie die Eintrag genau aussehen muss kannst
du ja bei dem gem mal nachschauen.

_________________
Grüße
Jack


Nach oben
 Profil  
 
 Betreff des Beitrags: Re: Probleme bei einem wsdl Beispiel
BeitragVerfasst: 14 Jun 2016, 14:52 
Offline
Nuby

Registriert: 13 Jun 2016, 15:34
Beiträge: 4
Hallo
hab was gefunden das nennt sich SOAP4R
hab auch mal ein besthenedes Beispiel Program umgebaut:



1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44

# Load library
require 'soap/wsdlDriver'

# URL for the service WSDL
wsdl = 'http://blahblah?wsdl'

# Query sequence
seq = ">Q8E5Q5_STRA3
MKLSKRYRFWQKVIKALGVLALIATLVLVVYLYKLGILNDSNELKDLVHKYEFWGPMIFI
VAQIVQIVFPVIPGGVTTVAGFLIFGPTLGFIYNYIGIIIGSVILFWLVKFYGRKFVLLF
MDQKTFDKYESKLETSGYEKFFIFCMASPISPADIMVMITGLSNMSIKRFVTIIMITKPI
SIIGYSYLWIYGGDILKNFLN
"


begin
# Get the object from the WSDL
fastaSrv = SOAP::WSDLDriverFactory.new(wsdl).create_rpc_driver

# Set the parameters for the job
params = {}
params['feld1'] = '0123'
params['feld2'] = 'M'

# Build the data structure
data = [{'type'=>'sequence', 'content'=>seq}]

# Submit the job
jobId = fastaSrv.moveFeld(params, data)

puts jobId

# Use the job identifier to check the status of the job
status = 'RUNNING'
while status=='RUNNING'
sleep 10
status = fastaSrv.checkStatus(jobId)
puts status
end

# When finished get the result
if status=='DONE'
puts fastaSrv.polljob(jobId, 'tooloutput')
end
end


hier die WSDL file


1
2
3
4
5
6
7
8
9
10

<soapenv:Envelope xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" xmlns:axis="http://ws.apache.org/axis2">
<soapenv:Header/>
<soapenv:Body>
<axis:moveFeld>
<feld1>0001</feld1>
<feld2>M</feld2>
</axis:moveFeld>
</soapenv:Body>
</soapenv:Envelope>


hab es soweit wie ich glaube am laufen und zwar so:
Aber ich bekomme eine Fehlermeldung:
.../1.8/rexml/encoding.rb:31 encoding Bad encoding name UTF-8 CHARSET=UTF-8(ArgumentError)
:cry:


1
2
3

params = {"feld1" =>"0123","feld2"=>"M"}
jobId = fastaSrv.moveFeld(params)


hab die Loesung:
fastaSrv.mandatorycharset = 'iso-8859-1'


Zuletzt geändert von NobbZ am 14 Jun 2016, 15:03, insgesamt 1-mal geändert.
Code-Tags


Nach oben
 Profil  
 
Beiträge der letzten Zeit anzeigen:  Sortiere nach  
Ein neues Thema erstellen Auf das Thema antworten  [ 7 Beiträge ] 

Alle Zeiten sind UTC + 1 Stunde [ Sommerzeit ]


Wer ist online?

Mitglieder in diesem Forum: 0 Mitglieder und 5 Gäste


Du darfst keine neuen Themen in diesem Forum erstellen.
Du darfst keine Antworten zu Themen in diesem Forum erstellen.
Du darfst deine Beiträge in diesem Forum nicht ändern.
Du darfst deine Beiträge in diesem Forum nicht löschen.
Du darfst keine Dateianhänge in diesem Forum erstellen.

Suche nach:
cron